Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4593 |
Product name: | Fgf9 (Mouse) Recombinant Protein |
Product description: | Mouse Fgf9 (P54130) recombinant protein expressed in Escherichia coli. |
Gene id: | 14180 |
Gene name: | Fgf9 |
Gene alias: | - |
Gene description: | fibroblast growth factor 9 |
Immunogen sequence/protein sequence: | MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Protein accession: | P54130 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | Lyophilized with 10 mM Na2PO4, 75 mM (NH4)2SO4, pH 7.5. |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Quality control testing picture note: | 3T3 cells were cultured with 0 to 100 ng/mL mouse Fgf9. Cell proliferation was measured after 42 hours and the linear portion of the curve was us used to calculate the ED50. |
Note: | Result of activity analysis |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Mouse |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |