Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ngf (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Ngf (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4591 |
| Product name: | Ngf (Mouse) Recombinant Protein |
| Product description: | Mouse Ngf (Q6LDU8) recombinant protein expressed in Escherichia coli. |
| Gene id: | 18049 |
| Gene name: | Ngf |
| Gene alias: | Ngfb |
| Gene description: | nerve growth factor |
| Immunogen sequence/protein sequence: | MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG |
| Protein accession: | Q6LDU8 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Serial dilutions of mouse Ngf, starting at 100 ng/mL, were added to TF-1 cells growing in GM-SCF free media. Cell proliferation was measure after 63 hours and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |