Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Il15 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Mouse |
| Host species | Escherichia coli (E. coli) |
| Applications | Func,SDS-PAGE |
More info about Il15 (Mouse) Recombinant Protein
| Reference: | P4587 |
| Product name: | Il15 (Mouse) Recombinant Protein |
| Product description: | Mouse Il15 (P48346) recombinant protein expressed in Escherichia coli (E. coli). |
| Gene id: | 16168 |
| Gene name: | Il15 |
| Gene alias: | AI503618 |
| Gene description: | interleukin 15 |
| Immunogen sequence/protein sequence: | MNWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS |
| Protein accession: | P48346 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | Lyophilized with 10 mM Na²PO4, pH 8.0. |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Shipping condition: | Dry Ice |