Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P4580 |
Product name: | IL22 (Human) Recombinant Protein |
Product description: | Human IL22 (Q9GZX6) recombinant protein expressed in Escherichia coli. |
Gene id: | 50616 |
Gene name: | IL22 |
Gene alias: | IL-21|IL-22|IL-D110|IL-TIF|IL21|ILTIF|MGC79382|MGC79384|TIFIL-23|TIFa|zcyto18 |
Gene description: | interleukin 22 |
Immunogen sequence/protein sequence: | MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Protein accession: | Q9GZX6 |
Form: | Lyophilized |
Preparation method: | Escherichia coli expression system |
Storage buffer: | Lyophilized with 10 mM sodium citrate, pH 3.0. |
Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Quality control testing picture: | ![]() |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |