Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CTGF (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about CTGF (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4578 |
| Product name: | CTGF (Human) Recombinant Protein |
| Product description: | Human CTGF (P29279) recombinant protein expressed in Escherichia coli. |
| Gene id: | 1490 |
| Gene name: | CTGF |
| Gene alias: | CCN2|HCS24|IGFBP8|MGC102839|NOV2 |
| Gene description: | connective tissue growth factor |
| Immunogen sequence/protein sequence: | MGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA |
| Protein accession: | P29279 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized with 10 mM sodium acetate, pH 6.0. |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with 5 mM sodium acetate, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Serial dilutions of human CTGF, starting at 10 ug/mL, were added to HUVECs cultured without EGF. Cell proliferation was measured after 87 hours and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |
| Publications: | Nell-1, HMGB1 and CCN2 enhance migration and vasculogenesis, but not osteogenic differentiation compared to BMP2.Fahmy-Garcia S, van Driel M, Witte-Buoma J, Walles H, van Leeuwen JP, van Osch G, Farrell E. Tissue Eng Part A. 2017 May 2. [Epub ahead of print] |