Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TGFB1 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Human |
| Applications | Func,SDS-PAGE |
More info about TGFB1 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4576 |
| Product name: | TGFB1 (Human) Recombinant Protein |
| Product description: | Human TGFB1 (P01137) recombinant protein expressed in HEK293 cells. |
| Gene id: | 7040 |
| Gene name: | TGFB1 |
| Gene alias: | CED|DPD1|TGFB|TGFbeta |
| Gene description: | transforming growth factor, beta 1 |
| Immunogen sequence/protein sequence: | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Protein accession: | P01137 |
| Form: | Lyophilized |
| Preparation method: | Mammalian cell (HEK293) expression system |
| Storage buffer: | Lyophilized with 10 mM HCl, 50 ug BSA per mg/mL of protein. |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Serial dilutions of Human TGFB1 (starting at 10 ng/mL) were added to HT-2 cultured with IL-4. Cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Human |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |