CXCL3 (Human) Recombinant Protein View larger

CXCL3 (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CXCL3 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about CXCL3 (Human) Recombinant Protein

Brand: Abnova
Reference: P4570
Product name: CXCL3 (Human) Recombinant Protein
Product description: Human CXCL3 (P19876) recombinant protein expressed in Escherichia coli.
Gene id: 2921
Gene name: CXCL3
Gene alias: CINC-2b|GRO3|GROg|MIP-2b|MIP2B|SCYB3
Gene description: chemokine (C-X-C motif) ligand 3
Immunogen sequence/protein sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Protein accession: P19876
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized with 10 mM Na2PO4, pH 7.5.
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy CXCL3 (Human) Recombinant Protein now

Add to cart