Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDGFA (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about PDGFA (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4567 |
| Product name: | PDGFA (Human) Recombinant Protein |
| Product description: | Human PDGFA (P04085) recombinant protein expressed in Escherichia coli. |
| Gene id: | 5154 |
| Gene name: | PDGFA |
| Gene alias: | PDGF-A|PDGF1 |
| Gene description: | platelet-derived growth factor alpha polypeptide |
| Immunogen sequence/protein sequence: | MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
| Protein accession: | P04085 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from a sterile filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Storage instruction: | Store at -20°C or -80°C. After reconstitution with 0.1 mL of sterilized water, store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Lane 1: non-reducing conditions Lane 2: reducing conditions |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |