Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CXCL12 (Beta) (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about CXCL12 (Beta) (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4566 |
| Product name: | CXCL12 (Beta) (Human) Recombinant Protein |
| Product description: | Human CXCL12 (beta) (P48061-1) recombinant protein expressed in Escherichia coli. |
| Gene id: | 6387 |
| Gene name: | CXCL12 |
| Gene alias: | PBSF|SCYB12|SDF-1a|SDF-1b|SDF1|SDF1A|SDF1B|TLSF-a|TLSF-b|TPAR1 |
| Gene description: | chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) |
| Immunogen sequence/protein sequence: | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Protein accession: | P48061-1 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Lane 1: non-reducing conditions Lane 2: reducing conditions |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |