Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Fgf1 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Fgf1 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4536 |
| Product name: | Fgf1 (Mouse) Recombinant Protein |
| Product description: | Mouse Fgf1 (NP_034327, 16 a.a. - 155 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 14164 |
| Gene name: | Fgf1 |
| Gene alias: | Dffrx|Fam|Fgf-1|Fgfa |
| Gene description: | fibroblast growth factor 1 |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Protein accession: | NP_034327 |
| Form: | Liquid |
| Concentration: | 1mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, 0.1 M NaCl, pH 8.0. (30% glycerol, 1 mM DTT) |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |