| Reference: | P4534 |
| Product name: | Csf1r (Mouse) Recombinant Protein |
| Product description: | Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 12978 |
| Gene name: | Csf1r |
| Gene alias: | AI323359|CD115|CSF-1R|Csfmr|Fim-2|Fms|M-CSFR |
| Gene description: | colony stimulating factor 1 receptor |
| Genbank accession: | NM_001037859 |
| Immunogen sequence/protein sequence: | ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD |
| Protein accession: | NP_001032948.2 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Shipping condition: | Dry Ice |