Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Cxcl16 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Mouse |
| Host species | Escherichia coli (E. coli) |
| Applications | SDS-PAGE |
More info about Cxcl16 (Mouse) Recombinant Protein
| Product description: | Mouse Cxcl16 (Q8BSU2, 88 amino acids) partial recombinant protein expressed in Escherichia coli (E. coli). |
| Gene id: | 66102 |
| Gene name: | Cxcl16 |
| Gene alias: | 0910001K24Rik|AV290116|BB024863|SR-PSOX|Zmynd15 |
| Gene description: | chemokine (C-X-C motif) ligand 16 |
| Immunogen sequence/protein sequence: | NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP |
| Protein accession: | Q8BSU2 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | Lyophilized from 20 mM sodium phosphate, 50 mM NaCl, pH 7.4 |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized ddH²O, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Size: | 25 ug |
| Shipping condition: | Dry Ice |