Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Fgf7 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Mouse |
| Host species | Escherichia coli (E. coli) |
| Applications | Func,SDS-PAGE |
More info about Fgf7 (Mouse) Recombinant Protein
| Product description: | Mouse Fgf7 (P36363, 164 amino acids) partial recombinant protein expressed in Escherichia coli (E. coli). |
| Gene id: | 14178 |
| Gene name: | Fgf7 |
| Gene alias: | Kgf |
| Gene description: | fibroblast growth factor 7 |
| Immunogen sequence/protein sequence: | MCNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT |
| Protein accession: | P36363 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli (E. coli) expression system |
| Storage buffer: | Lyophilized from 20 mM phosphate, 0.1M NaCl, pH 8.0 |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized ddH²O, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Size: | 10 ug |
| Shipping condition: | Dry Ice |