Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of VEGFA (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about VEGFA (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4444 |
| Product name: | VEGFA (Human) Recombinant Protein |
| Product description: | Human VEGFA (P15692-9) recombinant protein expressed in Escherichia coli. |
| Gene id: | 7422 |
| Gene name: | VEGFA |
| Gene alias: | MGC70609|VEGF|VEGF-A|VPF |
| Gene description: | vascular endothelial growth factor A |
| Immunogen sequence/protein sequence: | MPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR |
| Protein accession: | P15692-9 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Serial dilutions of human VEGFA (starting at 100 ng/mL) were added to HUVEC cells cultured without EGF. After 88 hours, cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |