Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNFSF11 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about TNFSF11 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4434 |
| Product name: | TNFSF11 (Human) Recombinant Protein |
| Product description: | Human TNFSF11 (O14788) recombinant protein expressed in Escherichia coli. |
| Gene id: | 8600 |
| Gene name: | TNFSF11 |
| Gene alias: | CD254|ODF|OPGL|OPTB2|RANKL|TRANCE|hRANKL2|sOdf |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 11 |
| Immunogen sequence/protein sequence: | EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Protein accession: | O14788 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from 10 mM Na2PO4, pH 8.0 |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Quality control testing picture note: | Human PBMCs were cultured with 0 to 1000 ng/mL human TNFSF11. Human IL8 production was measured after 48 hours and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |