| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P4432 |
| Product name: | NGF (Human) Recombinant Protein |
| Product description: | Human NGF (P01138) recombinant protein expressed in Escherichia coli. |
| Gene id: | 4803 |
| Gene name: | NGF |
| Gene alias: | Beta-NGF|HSAN5|MGC161426|MGC161428|NGFB |
| Gene description: | nerve growth factor (beta polypeptide) |
| Immunogen sequence/protein sequence: | MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
| Protein accession: | P01138 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Serial dilutions of human NGF, starting at 100 ng/mL, were added to TF-1 cells growing in GM-SCF free media. Cell proliferation was measure after 63 hours and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |