| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P4431 |
| Product name: | MSTN (Human) Recombinant Protein |
| Product description: | Human MSTN (O14793) recombinant protein expressed in Escherichia coli. |
| Gene id: | 2660 |
| Gene name: | MSTN |
| Gene alias: | GDF8 |
| Gene description: | myostatin |
| Immunogen sequence/protein sequence: | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
| Protein accession: | O14793 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with 20 mM HCl, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | MPC-11 cells were cultured with 0 to 500 ng/mL human MSTN. Cell proliferation was measured after 66 hours and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |