Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL21 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about IL21 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4412 |
| Product name: | IL21 (Human) Recombinant Protein |
| Product description: | Human IL21 (Q9HBE4) recombinant protein expressed in Escherichia coli. |
| Gene id: | 59067 |
| Gene name: | IL21 |
| Gene alias: | IL-21|Za11 |
| Gene description: | interleukin 21 |
| Immunogen sequence/protein sequence: | MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Protein accession: | Q9HBE4 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyopohilized from 20 mM Na2PO4, pH 7.5 |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Serial dilutions of human IL21 (starting at 50 ng/mL) were added to Mino cells. After 66 hours, cell proliferation was measured and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |