| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P4408 |
| Product name: | IL25 (Human) Recombinant Protein |
| Product description: | Human IL25 (Q9H293) recombinant protein expressed in Escherichia coli. |
| Gene id: | 64806 |
| Gene name: | IL25 |
| Gene alias: | IL-17E|IL-25|IL17E |
| Gene description: | interleukin 25 |
| Immunogen sequence/protein sequence: | MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
| Protein accession: | Q9H293 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized 10 mM HCl, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Human PBMCs were cultured with 0 to 1000 ng/mL human IL25. Human IL-8 production was measured after 48 hours and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |