Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IFNG (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about IFNG (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4400 |
| Product name: | IFNG (Human) Recombinant Protein |
| Product description: | Human IFNG (P01579) recombinant protein expressed in Escherichia coli. |
| Gene id: | 3458 |
| Gene name: | IFNG |
| Gene alias: | IFG|IFI |
| Gene description: | interferon, gamma |
| Immunogen sequence/protein sequence: | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
| Protein accession: | P01579 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from 5 mM Na2PO4, 50 mM NaCl, pH 7.2 |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing picture: |  |
| Quality control testing picture note: | The specific activity, as determined in a viral challenge assay using EMC virus on L929 cells, is 5.8-8.64 x 107 Units/mg. The corresponding ED50 is 0.02-0.011 ng/mL. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |