GH1 (Human) Recombinant Protein View larger

GH1 (Human) Recombinant Protein

New product

309,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GH1 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about GH1 (Human) Recombinant Protein

Brand: Abnova
Reference: P4397
Product name: GH1 (Human) Recombinant Protein
Product description: Human GH1 (P01241) recombinant protein expressed in Escherichia coli.
Gene id: 2688
Gene name: GH1
Gene alias: GH|GH-N|GHN|hGH-N
Gene description: growth hormone 1
Immunogen sequence/protein sequence: MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Protein accession: P01241
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from 20 mM NaHCO3, pH 8.0
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Quality control testing picture: note-P4397-1.jpg
Quality control testing picture note: Serial dilutions of human GH1, starting at 3 ng/mL, were added to PDF 9D11 cells. Proliferation was measured and the linear portion of the curve was us used to calculate the EC50.
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy GH1 (Human) Recombinant Protein now

Add to cart