Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GDF5 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about GDF5 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4393 |
| Product name: | GDF5 (Human) Recombinant Protein |
| Product description: | Human GDF5 (P43026) recombinant protein expressed in Escherichia coli. |
| Gene id: | 8200 |
| Gene name: | GDF5 |
| Gene alias: | BMP14|CDMP1|LAP4|SYNS2 |
| Gene description: | growth differentiation factor 5 |
| Immunogen sequence/protein sequence: | MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
| Protein accession: | P43026 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Serial dilutions of human GDF5, starting at 5 ug/mL, were added to ATDC-5 cells growing in the presence of 4 ug/mL heparin. Alkaline phosphate activity was measure after 67 hours and the linear portion of the curve was us used to calculate the ED50. |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |