View larger

LGALS3 (Human) Recombinant Protein

Reference:

Condition: New product

Data sheet of LGALS3 (Human) Recombinant Protein

Brand:	Abnova
Reference:	P4391
Product name:	LGALS3 (Human) Recombinant Protein
Product description:	Human LGALS3 (Q61BA7) recombinant protein expressed in Escherichia coli.
Gene id:	3958
Gene name:	LGALS3
Gene alias:	CBP35\|GAL3\|GALBP\|GALIG\|LGALS2\|MAC2
Gene description:	lectin, galactoside-binding, soluble, 3
Immunogen sequence/protein sequence:	MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Protein accession:	Q61BA7
Form:	Lyophilized
Preparation method:	Escherichia coli expression system
Storage buffer:	Lyophilized from 10 mM Na₂PO₄, 50 mM NaCl, pH 7.5
Storage instruction:	Store at -20Â°C on dry atmosphere. After reconstitution with sterilized water, store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture:
Quality control testing picture note:	Lane 1: reducing conditions Lane 2: non-reducing conditions
Note:	Result of activity analysis
Tag:	None
Product type:	Proteins
Host species:	Escherichia coli
Antigen species / target species:	Human
Applications:	Func,SDS-PAGE
Shipping condition:	Dry Ice