No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P4389 |
| Product name: | ADIPOQ (Human) Recombinant Protein |
| Product description: | Human ADIPOQ (Q15848) recombinant protein expressed in Escherichia coli. |
| Gene id: | 9370 |
| Gene name: | ADIPOQ |
| Gene alias: | ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin |
| Gene description: | adiponectin, C1Q and collagen domain containing |
| Immunogen sequence/protein sequence: | MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
| Protein accession: | Q15848 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from 10 mM Tris, pH 8.0 (0.75 mM DTT) |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized 5 mM Tris and 0.75 mM DTT to pH 8.0, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Lane 1: non-reducing conditions Lane 2: reducing conditions |
| Note: | Result of activity analysis |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |