ADIPOQ (Human) Recombinant Protein View larger

ADIPOQ (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADIPOQ (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about ADIPOQ (Human) Recombinant Protein

Brand: Abnova
Reference: P4389
Product name: ADIPOQ (Human) Recombinant Protein
Product description: Human ADIPOQ (Q15848) recombinant protein expressed in Escherichia coli.
Gene id: 9370
Gene name: ADIPOQ
Gene alias: ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin
Gene description: adiponectin, C1Q and collagen domain containing
Immunogen sequence/protein sequence: MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Protein accession: Q15848
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from 10 mM Tris, pH 8.0 (0.75 mM DTT)
Storage instruction: Store at -20°C on dry atmosphere.
After reconstitution with sterilized 5 mM Tris and 0.75 mM DTT to pH 8.0, store at -20°C or lower.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quality control testing picture: qc_test-P4389-1.jpg
Quality control testing picture note: Lane 1: non-reducing conditions
Lane 2: reducing conditions
Note: Result of activity analysis
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy ADIPOQ (Human) Recombinant Protein now

Add to cart