Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of S100a6 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about S100a6 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4347 |
| Product name: | S100a6 (Mouse) Recombinant Protein |
| Product description: | Mouse S100a6 (NP_035443, 1 a.a. - 89 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 20200 |
| Gene name: | S100a6 |
| Gene alias: | 2A9|5B10|CALCYCLIN|Cacy|PRA |
| Gene description: | S100 calcium binding protein A6 (calcyclin) |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK |
| Protein accession: | NP_035443 |
| Form: | Liquid |
| Concentration: | 0.5 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM dithiothreitol, 30% glycerol) |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |