Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Ifnb1 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about Ifnb1 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4337 |
| Product name: | Ifnb1 (Mouse) Recombinant Protein |
| Product description: | Mouse Ifnb1 (NP_034640, 22 a.a. - 182 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 15977 |
| Gene name: | Ifnb1 |
| Gene alias: | IFN-beta|IFNB|Ifb |
| Gene description: | interferon beta 1, fibroblast |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN |
| Protein accession: | NP_034640 |
| Form: | Liquid |
| Concentration: | 0.5 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, 0.1 M NaCl, pH 8.0 (30% glycerol) |
| Storage instruction: | Store at 4°C for short term (1-2 weeks). For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |