Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Gstm1 (Mouse) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about Gstm1 (Mouse) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4334 |
| Product name: | Gstm1 (Mouse) Recombinant Protein |
| Product description: | Mouse Gstm1 (NP_034488, 1 a.a. - 218 a.a.) full-length recombinant protein expressed in Escherichia coli. |
| Gene id: | 14862 |
| Gene name: | Gstm1 |
| Gene alias: | Gstb-1|Gstb1 |
| Gene description: | glutathione S-transferase, mu 1 |
| Immunogen sequence/protein sequence: | MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK |
| Protein accession: | NP_034488 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In PBS, pH 7.4. (5 mM glutathione) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C to -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |