| Brand: | Abnova |
| Reference: | P4329 |
| Product name: | Adipoq (Mouse) Recombinant Protein |
| Product description: | Mouse Adipoq (NP_033735, 18 a.a. - 247 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 11450 |
| Gene name: | Adipoq |
| Gene alias: | 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1 |
| Gene description: | adiponectin, C1Q and collagen domain containing |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
| Protein accession: | NP_033735 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris, pH 8.0 (1 mM dithiothreitol, 10% glycerol) |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Mouse |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |