Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UPK3A (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about UPK3A (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4324 |
| Product name: | UPK3A (Human) Recombinant Protein |
| Product description: | Human UPK3A (BAA31460, 19 a.a. - 207 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 7380 |
| Gene name: | UPK3A |
| Gene alias: | MGC119178|UPIII|UPIIIA|UPK3 |
| Gene description: | uroplakin 3A |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGG |
| Protein accession: | BAA31460 |
| Form: | Liquid |
| Concentration: | 0.25 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, 150 mM NaCl, pH 8.0. (20% glycerol, 2 mM DTT) |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |