Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CHD7 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about CHD7 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4184 |
| Product name: | CHD7 (Human) Recombinant Protein |
| Product description: | Human CHD7 (P39476, 64 amino acids) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 55636 |
| Gene name: | CHD7 |
| Gene alias: | FLJ20357|FLJ20361|IS3|KAL5|KIAA1416 |
| Gene description: | chromodomain helicase DNA binding protein 7 |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK |
| Protein accession: | P39476 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |