Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GDF11 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about GDF11 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4096 |
| Product name: | GDF11 (Human) Recombinant Protein |
| Product description: | Human GDF11 (dimer)(O95390, 136 amino acids) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 10220 |
| Gene name: | GDF11 |
| Gene alias: | BMP-11|BMP11 |
| Gene description: | growth differentiation factor 11 |
| Immunogen sequence/protein sequence: | ELRVLENTKRSRRNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCC |
| Protein accession: | O95390 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from 10 mM sodium citrate, pH 3.5. |
| Storage instruction: | The lyophilized protein is best-stored desiccated below 0°C. Reconstituted GDF11 should be stored in working aliquots at -20°C. Centrifuge the vial prior to opening. Reconstitute to a concentration of 0.1-1.0 mg/mL in water containing BSA (50 ug BSA per 1 ug of protein). This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |