Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TDGF1 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about TDGF1 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P4054 |
| Product name: | TDGF1 (Human) Recombinant Protein |
| Product description: | Human TDGF1 (P13385, 139 amino acids) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 6997 |
| Gene name: | TDGF1 |
| Gene alias: | CR|CRGF|CRIPTO|Cripto-1 |
| Gene description: | teratocarcinoma-derived growth factor 1 |
| Immunogen sequence/protein sequence: | LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPS |
| Protein accession: | P13385 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | No additive |
| Storage instruction: | Store at -80°C on dry atmosphere. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |