Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FLT1 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | WB,ELISA,IHC,Dot,SDS-PAGE |
More info about FLT1 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3832 |
| Product name: | FLT1 (Human) Recombinant Protein |
| Product description: | Human FLT1 (NP_002010.1, 31 a.a. - 328 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 2321 |
| Gene name: | FLT1 |
| Gene alias: | FLT|VEGFR1 |
| Gene description: | fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) |
| Immunogen sequence/protein sequence: | SLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI |
| Protein accession: | NP_002010.1 |
| Form: | Liquid |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In Tris (50% glycerol) |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 10% SDS-PAGE Result |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | WB,ELISA,IHC,Dot,SDS-PAGE |
| Shipping condition: | Dry Ice |