No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
| Brand: | Abnova |
| Reference: | P3806 |
| Product name: | HGF (Human) Recombinant Protein |
| Product description: | Human HGF (NP_000592.3, 495 a.a. - 728 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 3082 |
| Gene name: | HGF |
| Gene alias: | F-TCF|HGFB|HPTA|SF |
| Gene description: | hepatocyte growth factor (hepapoietin A; scatter factor) |
| Immunogen sequence/protein sequence: | VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS |
| Protein accession: | NP_000592.3 |
| Form: | Liquid |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In PBS (50% glycerol) |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 10% SDS-PAGE Result |
| Quality control testing picture: | ![]() |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |