PMP2 (Human) Recombinant Protein View larger

PMP2 (Human) Recombinant Protein

New product

259,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PMP2 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about PMP2 (Human) Recombinant Protein

Brand: Abnova
Reference: P3802
Product name: PMP2 (Human) Recombinant Protein
Product description: Human PMP2 (NP_002668.1, 1 a.a. - 132 a.a.) full-length recombinant protein expressed in Escherichia coli.
Gene id: 5375
Gene name: PMP2
Gene alias: FABP8|M-FABP|MP2|P2
Gene description: peripheral myelin protein 2
Immunogen sequence/protein sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Protein accession: NP_002668.1
Form: Liquid
Preparation method: Escherichia coli expression system
Storage buffer: In PBS (50% glycerol)
Storage instruction: Store at -20°C. For long term storage store at -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: 10% SDS-PAGE Result
Quality control testing picture: qc_test-P3802-1.jpg
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy PMP2 (Human) Recombinant Protein now

Add to cart