| Brand: | Abnova |
| Reference: | P3801 |
| Product name: | FABP2 (Human) Recombinant Protein |
| Product description: | Human FABP2 (NP_000125.1, 1 a.a. - 132 a.a.) full-length recombinant protein expressed in Escherichia coli. |
| Gene id: | 2169 |
| Gene name: | FABP2 |
| Gene alias: | FABPI|I-FABP|MGC133132 |
| Gene description: | fatty acid binding protein 2, intestinal |
| Immunogen sequence/protein sequence: | MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
| Protein accession: | NP_000125.1 |
| Form: | Liquid |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In PBS (50% glycerol) |
| Storage instruction: | Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 10% SDS-PAGE Result |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |