No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Proteins |
| Host species | Yeast |
| Applications | SDS-PAGE |
| Brand: | Abnova |
| Reference: | P3794 |
| Product name: | CXorf27 (Human) Recombinant Protein |
| Product description: | Human CXorf27 (NP_036406.1) full-length recombinant protein in yeast. |
| Gene id: | 25763 |
| Gene name: | CXorf27 |
| Gene alias: | 1700054O13Rik|HIP17|HYPM |
| Gene description: | chromosome X open reading frame 27 |
| Immunogen sequence/protein sequence: | MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND |
| Protein accession: | NP_036406.1 |
| Form: | Liquid |
| Preparation method: | Yeast expression system |
| Storage buffer: | In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Yeast |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |