Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C14orf166 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Yeast |
| Applications | SDS-PAGE |
More info about C14orf166 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3734 |
| Product name: | C14orf166 (Human) Recombinant Protein |
| Product description: | Human C14orf166 (NM_016039) full-length recombinant protein expressed in yeast. |
| Gene id: | 51637 |
| Gene name: | C14orf166 |
| Gene alias: | CGI-99|CGI99|CLE|CLE7|LCRP369|RLLM1 |
| Gene description: | chromosome 14 open reading frame 166 |
| Immunogen sequence/protein sequence: | MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR |
| Protein accession: | NM_016039 |
| Form: | Liquid |
| Preparation method: | Yeast expression system |
| Storage buffer: | In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol) |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Yeast |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |