Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDGFB (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Yeast |
| Applications | Func,SDS-PAGE |
More info about PDGFB (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3661 |
| Product name: | PDGFB (Human) Recombinant Protein |
| Product description: | Human PDGFB (P01127, 82 a.a. - 190 a.a.) partial recombinant protein expressed in Pichia pastoris. |
| Gene id: | 5155 |
| Gene name: | PDGFB |
| Gene alias: | FLJ12858|PDGF2|SIS|SSV|c-sis |
| Gene description: | platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) |
| Immunogen sequence/protein sequence: | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Protein accession: | P01127 |
| Form: | Lyophilized |
| Preparation method: | Pichia pastoris expression system |
| Storage buffer: | Lyophilized from 0.02 M acetic acid, pH 6.5 |
| Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Yeast |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |