Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NGF (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Hamster |
| Applications | Func,SDS-PAGE |
More info about NGF (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3657 |
| Product name: | NGF (Human) Recombinant Protein |
| Product description: | Human NGF (P01138, 122 a.a. - 241 a.a.) partial recombinant protein expressed in CHO cells. |
| Gene id: | 4803 |
| Gene name: | NGF |
| Gene alias: | Beta-NGF|HSAN5|MGC161426|MGC161428|NGFB |
| Gene description: | nerve growth factor (beta polypeptide) |
| Immunogen sequence/protein sequence: | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
| Protein accession: | P01138 |
| Form: | Lyophilized |
| Preparation method: | Mammalian cell (CHO) expression system |
| Storage buffer: | Lyophilized from 20 mM sodium acetate, 150 mM NaCl, pH 5.5 |
| Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Hamster |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |