Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CSF1 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Insect |
| Applications | Func,SDS-PAGE |
More info about CSF1 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3649 |
| Product name: | CSF1 (Human) Recombinant Protein |
| Product description: | Human CSF1 (P09603, 33 a.a. - 181 a.a.) partial recombinant protein expressed in baculovirus infected Bombyx Mori. |
| Gene id: | 1435 |
| Gene name: | CSF1 |
| Gene alias: | MCSF|MGC31930 |
| Gene description: | colony stimulating factor 1 (macrophage) |
| Immunogen sequence/protein sequence: | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ |
| Protein accession: | P09603 |
| Form: | Lyophilized |
| Preparation method: | Bombyx Mori expression system |
| Storage buffer: | Lyophilized from PBS, pH 7.0 (1% HSA, 3% mannitol) |
| Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Insect |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |