| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
| Brand: | Abnova |
| Reference: | P3648 |
| Product name: | CCL13 (Human) Recombinant Protein |
| Product description: | Human CCL13 (Q99616, 1 a.a. - 98 a.a.) full-length recombinant protein. expressed in Escherichia coli. |
| Gene id: | 6357 |
| Gene name: | CCL13 |
| Gene alias: | CKb10|MCP-4|MGC17134|NCC-1|NCC1|SCYA13|SCYL1 |
| Gene description: | chemokine (C-C motif) ligand 13 |
| Immunogen sequence/protein sequence: | MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
| Protein accession: | Q99616 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from 20 mM PB, 100mM NaCl, pH 7.5 |
| Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |