Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL12B (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Hamster |
| Applications | Func,SDS-PAGE |
More info about IL12B (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3629 |
| Product name: | IL12B (Human) Recombinant Protein |
| Product description: | Human IL12B (P29460, 23 a.a. - 529 a.a.) partial recombinant protein expressed in CHO cells. |
| Gene id: | 3593 |
| Gene name: | IL12B |
| Gene alias: | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
| Gene description: | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
| Immunogen sequence/protein sequence: | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
| Protein accession: | P29460 |
| Form: | Lyophilized |
| Preparation method: | Mammalian cell (CHO) expression system |
| Storage buffer: | Lyophilized from PBS, pH 7.5 |
| Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Hamster |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |