Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CXCL2 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about CXCL2 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3616 |
| Product name: | CXCL2 (Human) Recombinant Protein |
| Product description: | Human CXCL2 (P19875, 35 a.a. - 107 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 2920 |
| Gene name: | CXCL2 |
| Gene alias: | CINC-2a|GRO2|GROb|MGSA-b|MIP-2a|MIP2|MIP2A|SCYB2 |
| Gene description: | chemokine (C-X-C motif) ligand 2 |
| Immunogen sequence/protein sequence: | RAAGAPLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Protein accession: | P19875 |
| Form: | Lyophilized |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | Lyophilized from 20 mM Tris, pH 8.0 |
| Storage instruction: | Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing. |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |