TNFRSF13C (Human) Recombinant Protein View larger

TNFRSF13C (Human) Recombinant Protein

New product

309,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF13C (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about TNFRSF13C (Human) Recombinant Protein

Brand: Abnova
Reference: P3588
Product name: TNFRSF13C (Human) Recombinant Protein
Product description: Human TNFRSF13C (Q96RJ3, 1 a.a. - 79 a.a.) partial recombinant protein expressed in Escherichia coli.
Gene id: 115650
Gene name: TNFRSF13C
Gene alias: BAFF-R|BAFFR|CD268|MGC138235
Gene description: tumor necrosis factor receptor superfamily, member 13C
Immunogen sequence/protein sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLL
Protein accession: Q96RJ3
Form: Lyophilized
Preparation method: Escherichia coli expression system
Storage buffer: Lyophilized from 2.5% glycine, 0.5% sucrose, 0.01% Tween 80, 5 mM Glutamic acid, pH 4.5
Storage instruction: Store at -20°C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Tag: None
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy TNFRSF13C (Human) Recombinant Protein now

Add to cart