| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
| Brand: | Abnova |
| Reference: | P3551 |
| Product name: | RAB27A (Human) Recombinant Protein |
| Product description: | Human RAB27A (NP_899059, 1 a.a. - 221 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 5873 |
| Gene name: | RAB27A |
| Gene alias: | GS2|HsT18676|MGC117246|RAB27|RAM |
| Gene description: | RAB27A, member RAS oncogene family |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC |
| Protein accession: | NP_899059 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: | ![]() |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |
| Publications: | The Biological Activity of AAV Vectors for Choroideremia Gene Therapy Can Be Measured by In Vitro Prenylation of RAB6A.Patricio MI, Barnard AR, Cox CI, Blue C, MacLaren RE. Mol Ther Methods Clin Dev. 2018 Mar 28;9:288-295. doi: 10.1016/j.omtm.2018.03.009. eCollection 2018 Jun 15. |