No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | SDS-PAGE |
Brand: | Abnova |
Reference: | P3548 |
Product name: | LGALS9 (Human) Recombinant Protein |
Product description: | Human LGALS9 (NP_033665, 1 a.a. - 148 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
Gene id: | 3965 |
Gene name: | LGALS9 |
Gene alias: | HUAT|LGALS9A|MGC117375|MGC125973|MGC125974 |
Gene description: | lectin, galactoside-binding, soluble, 9 |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ |
Protein accession: | NP_033665 |
Form: | Liquid |
Concentration: | 0.5 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (20% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: | ![]() |
Tag: | His |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |