Cart 12 Product Products 3 838,70 € (empty)
No products
To be determined Shipping
3 838,70 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 12 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 838,70 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 838,70 €
Data sheet of DIABLO (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about DIABLO (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3525 |
| Product name: | DIABLO (Human) Recombinant Protein |
| Product description: | Human DIABLO (NP_063940, 56 a.a. - 239 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 56616 |
| Gene name: | DIABLO |
| Gene alias: | DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3 |
| Gene description: | diablo homolog (Drosophila) |
| Immunogen sequence/protein sequence: | MASMTGGQQMGRGSMAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
| Protein accession: | NP_063940 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris pH 7.5 |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |