Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ADIPOQ (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about ADIPOQ (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3520 |
| Product name: | ADIPOQ (Human) Recombinant Protein |
| Product description: | Human ADIPOQ (NP_004788, 15 a.a. - 244 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 9370 |
| Gene name: | ADIPOQ |
| Gene alias: | ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin |
| Gene description: | adiponectin, C1Q and collagen domain containing |
| Immunogen sequence/protein sequence: | MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
| Protein accession: | NP_004788 |
| Form: | Liquid |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In PBS, pH 7.4 (1 mM dithiothreitol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |