Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KIR3DL1 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about KIR3DL1 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3516 |
| Product name: | KIR3DL1 (Human) Recombinant Protein |
| Product description: | Human KIR3DL1 (NP_037421, 361 a.a. - 444 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 3811 |
| Gene name: | KIR3DL1 |
| Gene alias: | CD158E1|KIR|MGC119726|MGC119728|MGC126589|MGC126591|NKAT3|NKB1|NKB1B |
| Gene description: | killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1 |
| Immunogen sequence/protein sequence: | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSTSGTIDKLDIEFHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP |
| Protein accession: | NP_037421 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 25 mM Tris-HCl, 100mM NaCl, pH 7.5 |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 14% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |